PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 366aa    MW: 41751.4 Da    PI: 9.6683
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024392genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.8e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
      Lus10024392  4 RQRWRAEEDALLRSYVKQYGPREWNLVSQRMNtpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.61e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
      Lus10024392  59 KGSLTEEEQHLVIKLQEKYGNK-WKKIASEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.861153IPR017930Myb domain
SMARTSM007172.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466897.59E-22498IPR009057Homeodomain-like
CDDcd001672.81E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.1E-20660IPR009057Homeodomain-like
PfamPF139211.2E-14768No hitNo description
PROSITE profilePS5129422.96154108IPR017930Myb domain
SMARTSM007173.5E-958106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-1561102IPR009057Homeodomain-like
CDDcd001674.10E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MKERQRWRAE EDALLRSYVK QYGPREWNLV SQRMNTPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQHLV IKLQEKYGNK WKKIASEVPG RTAKRLGKWW EVFKEKQQRE KKETSKTPLE  120
PIDESKYDRI LETFAEKLVK ERTTPPPPPT GYPMAASNGS NYLHTPDHHH HHQHQHQPAM  180
LPPWLSSSSG GVRPPAAPSV TLSLSSSTVA GGGASPSIPW LQPADLPPPP PLPPPAGFSN  240
ESLVVNELVE CCRELDEGHR AWAAHKKEAA WRLRRVELQL ESEKSCRMKE KSEEIEAKIR  300
AMREEQKAAL DAIEAEYREQ LAGLRRDAEA KEQKLTDQWA AKHGRLTSFL EQMGCRTRLP  360
DPNGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-15792789C-Myb DNA-Binding Domain
1msf_C2e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019860.10.0PREDICTED: transcription factor AS1
RefseqXP_011019861.10.0PREDICTED: transcription factor AS1
RefseqXP_011019863.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-161AS1_ARATH; Transcription factor AS1
TrEMBLB9HBM21e-179B9HBM2_POPTR; Myb-related protein 91
STRINGPOPTR_0006s08610.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-144MYB family protein